HPA006139

PDIA4 antibody from Sigma-Aldrich
ERP70, ERP72
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006139
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006139, RRID:AB_1848256
Product name
Anti-PDIA4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006139
Antibody type
Polyclonal
Antigen
Protein disulfide-isomerase A4 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWR
SKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSES
GEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAF
KKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVM
DPKKD
Storage
-20C
Provider Type Product Number
- No reagents -