Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404854 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Adenosylhomocysteinase-Like 1 (AHCYL1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AHCYL1 antibody: synthetic peptide directed towards the N terminal of human AHCYL1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFC
VKNIK QAEFGRREIE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Suppression and overexpression of adenosylhomocysteine hydrolase-like protein 1 (AHCYL1) influences zebrafish embryo development: a possible role for AHCYL1 in inositol phospholipid signaling.
Cooper BJ, Key B, Carter A, Angel NZ, Hart DN, Kato M
The Journal of biological chemistry 2006 Aug 11;281(32):22471-84
The Journal of biological chemistry 2006 Aug 11;281(32):22471-84
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: AHCYL1 Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 μg/mL