ABIN487020

AHCYL1 antibody from antibodies-online
IRBIT, PPP1R78, XPVKONA

Antibody data

Product number
ABIN487020
Provider
antibodies-online
Product name
anti-Adenosylhomocysteinase-Like 1 (AHCYL1) antibody
Provider product page
antibodies-online - ABIN487020
Antibody type
Polyclonal
Antigen
The immunogen for anti-AHCYL1 antibody: synthetic peptide directed towards the N terminal of human AHCYL1
Reactivity
Human, Mouse, Bovine, Chicken/Avian
Host
Rabbit
Antigen sequence
MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVT
KAPKK QIQFADDMQE
Vial size
50 µg
Provider Type Product Number
- No reagents -