H00006767-M02

ST13 antibody from Abnova Corporation
FAM10A1, HIP, HSPABP1, P48, SNC6

Antibody data

Product number
H00006767-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006767-M02, RRID:AB_1580003
Product name
ST13 monoclonal antibody (M02), clone 2B2
Provider product page
Abnova Corporation - H00006767-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ST13.
Antigen sequence
MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQC
VLGLTQEQFLLDSLFDLFNLIIF
Isotype
IgG
Antibody clone number
2B2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -