Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006335-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006335-M01, RRID:AB_566197
- Product name
- SCN9A monoclonal antibody (M01), clone 5A11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SCN9A.
- Antigen sequence
GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYF
YYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPD
Y- Isotype
- IgG
- Antibody clone number
- 5A11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SCN9A monoclonal antibody (M01), clone 5A11. Western Blot analysis of SCN9A expression in rat testis.