Antibody data

Product number
ABIN503050
Provider
antibodies-online
Product name
anti-UDP-Gal:betaGlcNAc beta 1,3-Galactosyltransferase, Polypeptide 1 (B3GALT1) antibody
Provider product page
antibodies-online - ABIN503050
Antibody type
Polyclonal
Antigen
The immunogen for anti-B3GALT1 antibody: synthetic peptide directed towards the C terminal of human B3GALT1
Reactivity
Human, Mouse, Rat, Chicken/Avian
Host
Rabbit
Antigen sequence
YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFN
HWKMA YSLCRYRRVI
Vial size
50 µg
Provider Type Product Number
- No reagents -