Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00253782-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00253782-M01, RRID:AB_489924
- Product name
- LASS6 monoclonal antibody (M01), clone 5H7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LASS6.
- Antigen sequence
PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDE
KRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR- Isotype
- IgG
- Antibody clone number
- 5H7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Targeting ceramide synthase 6-dependent metastasis-prone phenotype in lung cancer cells.
Bcl2L13 is a ceramide synthase inhibitor in glioblastoma.
Modulation of ceramide synthase activity via dimerization.
D,L-Threo-1-phenyl-2-decanoylamino-3-morpholino-1-propanol (DL-PDMP) increases endoplasmic reticulum stress, autophagy and apoptosis accompanying ceramide accumulation via ceramide synthase 5 protein expression in A549 cells.
Ceramide synthases 2, 5, and 6 confer distinct roles in radiation-induced apoptosis in HeLa cells.
Suzuki M, Cao K, Kato S, Komizu Y, Mizutani N, Tanaka K, Arima C, Tai MC, Yanagisawa K, Togawa N, Shiraishi T, Usami N, Taniguchi T, Fukui T, Yokoi K, Wakahara K, Hasegawa Y, Mizutani Y, Igarashi Y, Inokuchi J, Iwaki S, Fujii S, Satou A, Matsumoto Y, Ueoka R, Tamiya-Koizumi K, Murate T, Nakamura M, Kyogashima M, Takahashi T
The Journal of clinical investigation 2016 Jan;126(1):254-65
The Journal of clinical investigation 2016 Jan;126(1):254-65
Bcl2L13 is a ceramide synthase inhibitor in glioblastoma.
Jensen SA, Calvert AE, Volpert G, Kouri FM, Hurley LA, Luciano JP, Wu Y, Chalastanis A, Futerman AH, Stegh AH
Proceedings of the National Academy of Sciences of the United States of America 2014 Apr 15;111(15):5682-7
Proceedings of the National Academy of Sciences of the United States of America 2014 Apr 15;111(15):5682-7
Modulation of ceramide synthase activity via dimerization.
Laviad EL, Kelly S, Merrill AH Jr, Futerman AH
The Journal of biological chemistry 2012 Jun 15;287(25):21025-33
The Journal of biological chemistry 2012 Jun 15;287(25):21025-33
D,L-Threo-1-phenyl-2-decanoylamino-3-morpholino-1-propanol (DL-PDMP) increases endoplasmic reticulum stress, autophagy and apoptosis accompanying ceramide accumulation via ceramide synthase 5 protein expression in A549 cells.
Yamane M, Miyazawa K, Moriya S, Abe A, Yamane S
Biochimie 2011 Sep;93(9):1446-59
Biochimie 2011 Sep;93(9):1446-59
Ceramide synthases 2, 5, and 6 confer distinct roles in radiation-induced apoptosis in HeLa cells.
Mesicek J, Lee H, Feldman T, Jiang X, Skobeleva A, Berdyshev EV, Haimovitz-Friedman A, Fuks Z, Kolesnick R
Cellular signalling 2010 Sep;22(9):1300-7
Cellular signalling 2010 Sep;22(9):1300-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LASS6 monoclonal antibody (M01), clone 5H7 Western Blot analysis of LASS6 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LASS6 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to LASS6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol