Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [9]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00253782-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00253782-A01, RRID:AB_462795
- Product name
- LASS6 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant LASS6.
- Antigen sequence
PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDE
KRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cytochrome c oxidase deficiency accelerates mitochondrial apoptosis by activating ceramide synthase 6.
Radiation-induced acid ceramidase confers prostate cancer resistance and tumor relapse.
Ceramide synthase 6 knockdown suppresses apoptosis after photodynamic therapy in human head and neck squamous carcinoma cells.
siRNA-mediated down-regulation of ceramide synthase 1 leads to apoptotic resistance in human head and neck squamous carcinoma cells after photodynamic therapy.
Alteration of ceramide synthase 6/C16-ceramide induces activating transcription factor 6-mediated endoplasmic reticulum (ER) stress and apoptosis via perturbation of cellular Ca2+ and ER/Golgi membrane network.
Antiapoptotic roles of ceramide-synthase-6-generated C16-ceramide via selective regulation of the ATF6/CHOP arm of ER-stress-response pathways.
Ceramide synthase 6 modulates TRAIL sensitivity and nuclear translocation of active caspase-3 in colon cancer cells.
Role of human longevity assurance gene 1 and C18-ceramide in chemotherapy-induced cell death in human head and neck squamous cell carcinomas.
JNK3 signaling pathway activates ceramide synthase leading to mitochondrial dysfunction.
Schüll S, Günther SD, Brodesser S, Seeger JM, Tosetti B, Wiegmann K, Pongratz C, Diaz F, Witt A, Andree M, Brinkmann K, Krönke M, Wiesner RJ, Kashkar H
Cell death & disease 2015 Mar 12;6:e1691
Cell death & disease 2015 Mar 12;6:e1691
Radiation-induced acid ceramidase confers prostate cancer resistance and tumor relapse.
Cheng JC, Bai A, Beckham TH, Marrison ST, Yount CL, Young K, Lu P, Bartlett AM, Wu BX, Keane BJ, Armeson KE, Marshall DT, Keane TE, Smith MT, Jones EE, Drake RR Jr, Bielawska A, Norris JS, Liu X
The Journal of clinical investigation 2013 Oct;123(10):4344-58
The Journal of clinical investigation 2013 Oct;123(10):4344-58
Ceramide synthase 6 knockdown suppresses apoptosis after photodynamic therapy in human head and neck squamous carcinoma cells.
Separovic D, Breen P, Joseph N, Bielawski J, Pierce JS, VAN Buren E, Gudz TI
Anticancer research 2012 Mar;32(3):753-60
Anticancer research 2012 Mar;32(3):753-60
siRNA-mediated down-regulation of ceramide synthase 1 leads to apoptotic resistance in human head and neck squamous carcinoma cells after photodynamic therapy.
Separovic D, Breen P, Joseph N, Bielawski J, Pierce JS, VAN Buren E, Gudz TI
Anticancer research 2012 Jul;32(7):2479-85
Anticancer research 2012 Jul;32(7):2479-85
Alteration of ceramide synthase 6/C16-ceramide induces activating transcription factor 6-mediated endoplasmic reticulum (ER) stress and apoptosis via perturbation of cellular Ca2+ and ER/Golgi membrane network.
Senkal CE, Ponnusamy S, Manevich Y, Meyers-Needham M, Saddoughi SA, Mukhopadyay A, Dent P, Bielawski J, Ogretmen B
The Journal of biological chemistry 2011 Dec 9;286(49):42446-58
The Journal of biological chemistry 2011 Dec 9;286(49):42446-58
Antiapoptotic roles of ceramide-synthase-6-generated C16-ceramide via selective regulation of the ATF6/CHOP arm of ER-stress-response pathways.
Senkal CE, Ponnusamy S, Bielawski J, Hannun YA, Ogretmen B
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2010 Jan;24(1):296-308
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2010 Jan;24(1):296-308
Ceramide synthase 6 modulates TRAIL sensitivity and nuclear translocation of active caspase-3 in colon cancer cells.
White-Gilbertson S, Mullen T, Senkal C, Lu P, Ogretmen B, Obeid L, Voelkel-Johnson C
Oncogene 2009 Feb 26;28(8):1132-41
Oncogene 2009 Feb 26;28(8):1132-41
Role of human longevity assurance gene 1 and C18-ceramide in chemotherapy-induced cell death in human head and neck squamous cell carcinomas.
Senkal CE, Ponnusamy S, Rossi MJ, Bialewski J, Sinha D, Jiang JC, Jazwinski SM, Hannun YA, Ogretmen B
Molecular cancer therapeutics 2007 Feb;6(2):712-22
Molecular cancer therapeutics 2007 Feb;6(2):712-22
JNK3 signaling pathway activates ceramide synthase leading to mitochondrial dysfunction.
Yu J, Novgorodov SA, Chudakova D, Zhu H, Bielawska A, Bielawski J, Obeid LM, Kindy MS, Gudz TI
The Journal of biological chemistry 2007 Aug 31;282(35):25940-9
The Journal of biological chemistry 2007 Aug 31;282(35):25940-9
No comments: Submit comment
No validations: Submit validation data