Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502897 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Ceramide Synthase 6 (CERS6) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LASS6 antibody: synthetic peptide directed towards the N terminal of human LASS6
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQA
EDLYL AFPLAFCIFM- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Creation of genome-wide protein expression libraries using random activation of gene expression.
Harrington JJ, Sherf B, Rundlett S, Jackson PD, Perry R, Cain S, Leventhal C, Thornton M, Ramachandran R, Whittington J, Lerner L, Costanzo D, McElligott K, Boozer S, Mays R, Smith E, Veloso N, Klika A, Hess J, Cothren K, Lo K, Offenbacher J, Danzig J, Ducar M
Nature biotechnology 2001 May;19(5):440-5
Nature biotechnology 2001 May;19(5):440-5
No comments: Submit comment
No validations: Submit validation data