HPA000918

PPP1R3F antibody from Sigma-Aldrich
Hb2E
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000918
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000918, RRID:AB_2268692
Product name
Anti-PPP1R3F antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000918
Antibody type
Polyclonal
Antigen
Protein phosphatase 1 regulatory subunit 3F recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TDGGMSPSHPLGILTDRDLILKWPGPERALNSALA
EEITLHYARLGRGVELIKDTEDPDDEGEGEEGLSV
TPSSPEGDSPKESPPEILSGARSVVATMGDVWLP
Storage
-20C
Provider Type Product Number
- No reagents -