HPA000918

PPP1R3F antibody from MilliporeSigma / Merck KGaA
Hb2E
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000918
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-PPP1R3F antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA000918
Antibody type
Polyclonal
Antigen
Protein phosphatase 1 regulatory subunit 3F recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TDGGMSPSHPLGILTDRDLILKWPGPERALNSALA
EEITLHYARLGRGVELIKDTEDPDDEGEGEEGLSV
TPSSPEGDSPKESPPEILSGARSVVATMGDVWLP
Storage
-20C