H00010170-A01

DHRS9 antibody from Abnova Corporation
3alpha-HSD, RDH15, RDHL, RETSDR8, SDR9C4
No application information provided.

Antibody data

Product number
H00010170-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010170-A01, RRID:AB_1139195
Product name
DHRS9 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00010170-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant DHRS9.
Antigen sequence
MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFIT
GCDSGFGNLAARTFDKKGFHVIAACLTESGSTALK
AETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKG
LWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFG
LISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGG
YTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFK
TNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEK
SLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTH
YAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELAN
PKAV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -