PAB22074

INKA2 antibody from Abnova Corporation
C1orf183, FAM212B, FLJ31105

Antibody data

Product number
PAB22074
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22074, RRID:AB_10964932
Product name
FAM212B polyclonal antibody
Provider product page
Abnova Corporation - PAB22074
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FAM212B.
Antigen sequence
MTMESREMDCYLRRLKQELMSMKEVGDGLQDQMNC
MMGALQELKLLQVQTALEQLEISGGGPVPGSPEGP
RTQC
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.