HPA027809

INKA2 antibody from Sigma-Aldrich
C1orf183, FAM212B, FLJ31105
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027809
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027809, RRID:AB_10599616
Product name
Anti-C1orf183 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027809
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf183 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTMESREMDCYLRRLKQELMSMKEVGDGLQDQMNC
MMGALQELKLLQVQTALEQLEISGGGPVPGSPEGP
RTQC
Storage
-20C
Provider Type Product Number
- No reagents -