HPA027811

INKA2 antibody from MilliporeSigma / Merck KGaA
C1orf183, FAM212B, FLJ31105
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027811
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027811, RRID:AB_10600872
Product name
Anti-C1orf183 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027811
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf183 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHPCWEGGRGPARPTVCSPSSQPSLGSSTKFPSHR
SVCGRDLAPLPRTQPHQSCAQQGPERVEPDDWTST
LMSR
Storage
-20C
Provider Type Product Number
- No reagents -