Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005437-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005437-M01, RRID:AB_464320
- Product name
- POLR2H monoclonal antibody (M01), clone 3G6-1A4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant POLR2H.
- Antigen sequence
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESF
KMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTL
DDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETS
TEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSR
VYLLMKKLAF- Isotype
- IgG
- Antibody clone number
- 3G6-1A4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Examining the complexity of human RNA polymerase complexes using HaloTag technology coupled to label free quantitative proteomics.
Daniels DL, Méndez J, Mosley AL, Ramisetty SR, Murphy N, Benink H, Wood KV, Urh M, Washburn MP
Journal of proteome research 2012 Feb 3;11(2):564-75
Journal of proteome research 2012 Feb 3;11(2):564-75
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- POLR2H monoclonal antibody (M01), clone 3G6-1A4 Western Blot analysis of POLR2H expression in Hela ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- POLR2H monoclonal antibody (M01), clone 3G6-1A4. Western Blot analysis of POLR2H expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of POLR2H expression in transfected 293T cell line by POLR2H monoclonal antibody (M01), clone 3G6-1A4.Lane 1: POLR2H transfected lysate(17.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged POLR2H is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol