Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000829-A02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000829-A02, RRID:AB_489499
- Product name
- CAPZA1 polyclonal antibody (A02)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CAPZA1.
- Antigen sequence
LGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGG
LKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQ
QTIIACIESHQFQPKNFWN- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references HDAC2 and TXNL1 distinguish aneuploid from diploid colorectal cancers.
Gemoll T, Roblick UJ, Szymczak S, Braunschweig T, Becker S, Igl BW, Bruch HP, Ziegler A, Hellman U, Difilippantonio MJ, Ried T, Jörnvall H, Auer G, Habermann JK
Cellular and molecular life sciences : CMLS 2011 Oct;68(19):3261-74
Cellular and molecular life sciences : CMLS 2011 Oct;68(19):3261-74
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CAPZA1 polyclonal antibody (A02), Lot # 060109JC01 Western Blot analysis of CAPZA1 expression in HL-60 ( Cat # L014V1 ).