Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000389-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000389-M01, RRID:AB_733245
- Product name
- RHOC monoclonal antibody (M01), clone 2E12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant RHOC.
- Antigen sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYV
PTVFENYIADIEVDGKQVELALWDTAGQEDYDRLR
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKH
FCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVR
SEEGRDMANRISAFGYLECSAKTKEGVREVFEMAT
RAGLQVRKNKRRRGCPIL- Isotype
- IgG
- Antibody clone number
- 2E12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Epidermal growth factor stimulates human trophoblast cell migration through Rho A and Rho C activation.
Han J, Li L, Hu J, Yu L, Zheng Y, Guo J, Zheng X, Yi P, Zhou Y
Endocrinology 2010 Apr;151(4):1732-42
Endocrinology 2010 Apr;151(4):1732-42
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RHOC expression in transfected 293T cell line by RHOC monoclonal antibody (M01), clone 2E12.Lane 1: RHOC transfected lysate(22 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RHOC monoclonal antibody (M01), clone 2E12. Western Blot analysis of RHOC expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RHOC is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol