Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009175-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009175-M04, RRID:AB_1576950
- Product name
- MAP3K13 monoclonal antibody (M04), clone 4H7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAP3K13.
- Antigen sequence
SEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDI
PSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENE
FSGCRSESSLGTSHLGTPPALPRKTRPLQK- Isotype
- IgG
- Antibody clone number
- 4H7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MAP3K13 expression in transfected 293T cell line by MAP3K13 monoclonal antibody (M04), clone 4H7.Lane 1: MAP3K13 transfected lysate (Predicted MW: 108.3 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MAP3K13 monoclonal antibody (M04), clone 4H7. Western Blot analysis of MAP3K13 expression in Jurkat.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to MAP3K13 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol