Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [2]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA035275 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA035275, RRID:AB_10602600
- Product name
- Anti-GORASP2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLS
SVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVL
STGV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GORASP2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line HepG2.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Enhanced validation
Supportive validation
- Submitted by
- 55af80e3e0991
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Confocal images of immunofluorescently stained human U-2 OS cells.The protein GORASP2 is shown in green. The image to the left show cells transfected with control siRNA and the image to the right show cells where GORASP2 has been downregulated with specific siRNA.
- Sample type
- U-2 OS cells
- Primary Ab dilution
- 1:43
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:800
- Knockdown/Genetic Approaches Application
- Immunocytochemistry
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows membranous positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN