HPA018852

C1S antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018852
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018852, RRID:AB_1847112
Product name
Anti-C1S antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018852
Antibody type
Polyclonal
Antigen
Complement C1s subcomponent precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AAHVVEGNREPTMYVGSTSVQTSRLAKSKMLTPEH
VFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMG
PTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRD
RAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVF
TPNMICAGGE
Storage
-20C
Provider Type Product Number
- No reagents -