Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406681 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Insulin-Like Growth Factor 2 MRNA Binding Protein 1 (IGF2BP1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IGF2BP1 antibody: synthetic peptide directed towards the middle region of human IGF2BP1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
YKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQ
QQDFS IGSQKLSKAI- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Quantitative trait analysis of type 2 diabetes susceptibility loci identified from whole genome association studies in the Insulin Resistance Atherosclerosis Family Study.
Palmer ND, Goodarzi MO, Langefeld CD, Ziegler J, Norris JM, Haffner SM, Bryer-Ash M, Bergman RN, Wagenknecht LE, Taylor KD, Rotter JI, Bowden DW
Diabetes 2008 Apr;57(4):1093-100
Diabetes 2008 Apr;57(4):1093-100
No comments: Submit comment
No validations: Submit validation data