HPA001667

PAPPA antibody from Atlas Antibodies
ASBABP2, DIPLA1, IGFBP-4ase, PAPA, PAPP-A, PAPPA1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001667
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001667, RRID:AB_1854960
Product name
Anti-PAPPA
Provider product page
Atlas Antibodies - HPA001667
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVC
TAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRA
FCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACR
DPQAQEHSRKDL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -