HPA001667

PAPPA antibody from Sigma-Aldrich
ASBABP2, DIPLA1, IGFBP-4ase, PAPA, PAPP-A, PAPPA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001667
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001667, RRID:AB_1854960
Product name
Anti-PAPPA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001667
Antibody type
Polyclonal
Antigen
Pappalysin-1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVC
TAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRA
FCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACR
DPQAQEHSRKDL
Storage
-20C
Provider Type Product Number
- No reagents -