HPA028399

AP4B1 antibody from MilliporeSigma / Merck KGaA
BETA-4, SPG47
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028399
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028399, RRID:AB_10600332
Product name
Anti-AP4B1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028399
Antibody type
Polyclonal
Antigen
adaptor-related protein complex 4, beta1 subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DMLGRLLYYCIEEEKDMAVRDRGLFYYRLLLVGID
EVKRILCSPKSDPTLGLLEDPAERPVNSWASDFNT
LVPVYGKAHWATISKCQG
Storage
-20C
Provider Type Product Number
- No reagents -