Antibody data

Product number
ABIN405405
Provider
antibodies-online
Product name
anti-Neuregulin 1 (NRG1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405405
Antibody type
Polyclonal
Antigen
The immunogen for anti-HRG antibody: synthetic peptide directed towards the middle region of human HRG
Description
Affinity Purified
Reactivity
Human, Rabbit
Host
Rabbit
Antigen sequence
EVLPLPEANFPSFPLPHHKHPLKPDNQPFPQSVSE
SCPGK FKSGFPQVSM
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -