Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406384 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Gelsolin (GSN) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GSN antibody: synthetic peptide directed towards the C terminal of human GSN
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGAT
RAVEV LPKAGALNSN- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Ardalan-Shoja-Kiuru syndrome--hereditary gelsolin amyloidosis plus retinitis pigmentosa.
Shokouhi G, Khosroshahi HT
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2008 Mar;23(3):1071; author reply 1071-2
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2008 Mar;23(3):1071; author reply 1071-2
No comments: Submit comment
No validations: Submit validation data