Antibody data

Product number
ABIN406384
Provider
antibodies-online
Product name
anti-Gelsolin (GSN) (C-Term) antibody
Provider product page
antibodies-online - ABIN406384
Antibody type
Polyclonal
Antigen
The immunogen for anti-GSN antibody: synthetic peptide directed towards the C terminal of human GSN
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
Host
Rabbit
Antigen sequence
KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGAT
RAVEV LPKAGALNSN
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -