Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002257-M10 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002257-M10, RRID:AB_565725
- Product name
- FGF12 monoclonal antibody (M10), clone 1D9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant FGF12.
- Antigen sequence
MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTK
DENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGE
GYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQ
ESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKP
IEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKV
VNQDST- Isotype
- IgG
- Antibody clone number
- 1D9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
Chattopadhyay I, Singh A, Phukan R, Purkayastha J, Kataki A, Mahanta J, Saxena S, Kapur S
Mutation research 2010 Feb;696(2):130-8
Mutation research 2010 Feb;696(2):130-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FGF12 expression in transfected 293T cell line by FGF12 monoclonal antibody (M10), clone 1D9.Lane 1: FGF12 transfected lysate(27.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FGF12 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to FGF12 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol