H00001123-M03
antibody from Abnova Corporation
Targeting: CHN1
ARHGAP2, CHN, DURS2, n-chimerin, RhoGAP2
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001123-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001123-M03, RRID:AB_622286
- Product name
- CHN1 monoclonal antibody (M03), clone 3A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CHN1.
- Antigen sequence
QTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLY
IETKAAEYIAKMTINPIYEHVGYTTLNREPAYKKH
MPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKE
NEQIP- Isotype
- IgG
- Antibody clone number
- 3A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Tsc2-Rheb signaling regulates EphA-mediated axon guidance.
Nie D, Di Nardo A, Han JM, Baharanyi H, Kramvis I, Huynh T, Dabora S, Codeluppi S, Pandolfi PP, Pasquale EB, Sahin M
Nature neuroscience 2010 Feb;13(2):163-72
Nature neuroscience 2010 Feb;13(2):163-72
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CHN1 monoclonal antibody (M03), clone 3A3. Western Blot analysis of CHN1 expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CHN1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol