Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029471 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029471, RRID:AB_10600784
- Product name
- Anti-ATP13A3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ICGQLNLVCFDKTGTLTEDGLDLWGIQRVENARFL
SPEENVCNEMLVKSQFVACMATCHSLTKIEGVLSG
DPLDLKMFEAIGWILEEATEEETALHNRIMPTVVR
PPKQLLPESTPAGNQEMELFELPATYEIGIVRQFP
FSSA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Novel Green Fluorescent Polyamines to Analyze ATP13A2 and ATP13A3 Activity in the Mammalian Polyamine Transport System.
ATP13A3 facilitates polyamine transport in human pancreatic cancer cells
ATP13A3 is a major component of the enigmatic mammalian polyamine transport system
Houdou M, Jacobs N, Coene J, Azfar M, Vanhoutte R, Van den Haute C, Eggermont J, Daniëls V, Verhelst SHL, Vangheluwe P
Biomolecules 2023 Feb 9;13(2)
Biomolecules 2023 Feb 9;13(2)
ATP13A3 facilitates polyamine transport in human pancreatic cancer cells
Sekhar V, Andl T, Phanstiel O
Scientific Reports 2022;12(1)
Scientific Reports 2022;12(1)
ATP13A3 is a major component of the enigmatic mammalian polyamine transport system
Hamouda N, Van den Haute C, Vanhoutte R, Sannerud R, Azfar M, Mayer R, Cortés Calabuig Á, Swinnen J, Agostinis P, Baekelandt V, Annaert W, Impens F, Verhelst S, Eggermont J, Martin S, Vangheluwe P
Journal of Biological Chemistry 2021;296
Journal of Biological Chemistry 2021;296
No comments: Submit comment
No validations: Submit validation data