ABIN311632

TENT5C antibody from antibodies-online
FAM46C, FLJ20202
Western blot
Data presented on provider website

Antibody data

Product number
ABIN311632
Provider
antibodies-online
Product name
anti-Family with Sequence Similarity 46, Member C (FAM46C) antibody
Provider product page
antibodies-online - ABIN311632
Antibody type
Polyclonal
Antigen
The immunogen for anti-FAM46C antibody: synthetic peptide directed towards the middle region of human FAM46C
Reactivity
Human, Mouse, Rat, Chicken/Avian
Host
Rabbit
Antigen sequence
LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIK
TLERY MCSRFFIDFP
Vial size
50 µg