AV53723

TENT5C antibody from MilliporeSigma / Merck KGaA
FAM46C, FLJ20202
No application information provided.

Antibody data

Product number
AV53723
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-FAM46C antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV53723
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human FAM46C with an internal ID of P30563
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRDFRPTDQEEIKTLERYMCSRFFIDFPDILEQQR
KLETYLQNHFAEEER
Storage
-20C