PAB22044

WDR3 antibody from Abnova Corporation
DIP2, FLJ12796, UTP12

Antibody data

Product number
PAB22044
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22044, RRID:AB_10962031
Product name
WDR3 polyclonal antibody
Provider product page
Abnova Corporation - PAB22044
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant WDR3.
Antigen sequence
AKEDQPAVPGETQGDSYFTGKKTIETVKAAERIME
AIELYREETAKMKEHKAICKAAGKEVPLPSNPILM
AYGSISPSAYVLEIFKGIKSSELEESLLVLP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.