SAB2102697

WDR3 antibody from MilliporeSigma / Merck KGaA
DIP2, FLJ12796, UTP12
No application information provided.

Antibody data

Product number
SAB2102697
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-WDR3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2102697
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_006775.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEK
KRKRKKREKLILTLT
Storage
-20C