Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005255-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005255-A01, RRID:AB_489366
- Product name
- PHKA1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PHKA1.
- Antigen sequence
DYDDNYDYLESGNWMNDYDSTSHARCGDEVARYLD
HLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLM
SLVTKAKELHVQNVHMYLPTKLFQASRPSF- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A kinome-targeted RNAi-based screen links FGF signaling to H2AX phosphorylation in response to radiation.
Alpha-actinin-3 deficiency results in reduced glycogen phosphorylase activity and altered calcium handling in skeletal muscle.
Benzina S, Pitaval A, Lemercier C, Lustremant C, Frouin V, Wu N, Papine A, Soussaline F, Romeo PH, Gidrol X
Cellular and molecular life sciences : CMLS 2015 Sep;72(18):3559-73
Cellular and molecular life sciences : CMLS 2015 Sep;72(18):3559-73
Alpha-actinin-3 deficiency results in reduced glycogen phosphorylase activity and altered calcium handling in skeletal muscle.
Quinlan KG, Seto JT, Turner N, Vandebrouck A, Floetenmeyer M, Macarthur DG, Raftery JM, Lek M, Yang N, Parton RG, Cooney GJ, North KN
Human molecular genetics 2010 Apr 1;19(7):1335-46
Human molecular genetics 2010 Apr 1;19(7):1335-46
No comments: Submit comment
No validations: Submit validation data