HPA010973

PYY antibody from Sigma-Aldrich
PYY1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010973
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010973, RRID:AB_1855194
Product name
Anti-PYY antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010973
Antibody type
Polyclonal
Antigen
Peptide YY Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
GKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW
Storage
-20C
Provider Type Product Number
- No reagents -