Antibody data

Product number
H00003284-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003284-M02, RRID:AB_1237741
Product name
HSD3B2 monoclonal antibody (M02), clone 1E8
Provider product page
Abnova Corporation - H00003284-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HSD3B2.
Antigen sequence
ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPF
LKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVK
GTQLLLEACVQASVPVFIYT
Isotype
IgG
Antibody clone number
1E8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -