Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003284-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003284-M02, RRID:AB_1237741
- Product name
- HSD3B2 monoclonal antibody (M02), clone 1E8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HSD3B2.
- Antigen sequence
ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPF
LKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVK
GTQLLLEACVQASVPVFIYT- Isotype
- IgG
- Antibody clone number
- 1E8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Pomegranate extracts impact the androgen biosynthesis pathways in prostate cancer models in vitro and in vivo.
Ming DS, Pham S, Deb S, Chin MY, Kharmate G, Adomat H, Beheshti EH, Locke J, Guns ET
The Journal of steroid biochemistry and molecular biology 2014 Sep;143:19-28
The Journal of steroid biochemistry and molecular biology 2014 Sep;143:19-28
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HSD3B2 expression in transfected 293T cell line by HSD3B2 monoclonal antibody (M02), clone 1E8.Lane 1: HSD3B2 transfected lysate(42.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HSD3B2 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol