Antibody data

Product number
H00003231-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003231-M01, RRID:AB_1204493
Product name
HOXD1 monoclonal antibody (M01), clone 4F4
Provider product page
Abnova Corporation - H00003231-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HOXD1.
Antigen sequence
QVDYAAFGEPGPFPACLKASADGHPGAFQTASPAP
GTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKL
AEYGAASPSSAIRTNFSTKQ
Isotype
IgG
Antibody clone number
4F4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -