Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002243-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002243-M01, RRID:AB_1111836
- Product name
- FGA monoclonal antibody (M01), clone 1D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant FGA.
- Antigen sequence
MFSMSIVCLVLSVVGTAWTADSGEGDFLAEGGGVR
GPRVVERHQSACKDSDWPFCSGEDWNYKCPSGCRM
KGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSL
TTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIEV
LKRKVIEKVTANNLLVARVTTEETPHLKARAIKWQ
MRPEVKPIMKEHIAPREAMLNLALSEVSTLLLWGS
LPCPPRLS- Isotype
- IgG
- Antibody clone number
- 1D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FGA expression in transfected 293T cell line by FGA monoclonal antibody (M01), clone 1D12.Lane 1: FGA transfected lysate(24.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FGA is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of FGA transfected lysate using anti-FGA monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FGA MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between APOA1 and FGA. HeLa cells were stained with anti-APOA1 rabbit purified polyclonal 1:1200 and anti-FGA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)