Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405425 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Fibrinogen alpha Chain (FGA) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FGA antibody: synthetic peptide directed towards the middle region of human FGA
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSE
ADHEG THSTKRGHAK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mast cell restricted mouse and human tryptase·heparin complexes hinder thrombin-induced coagulation of plasma and the generation of fibrin by proteolytically destroying fibrinogen.
Fibrinogen gene variation and ischemic stroke.
Prieto-García A, Zheng D, Adachi R, Xing W, Lane WS, Chung K, Anderson P, Hansbro PM, Castells M, Stevens RL
The Journal of biological chemistry 2012 Mar 9;287(11):7834-44
The Journal of biological chemistry 2012 Mar 9;287(11):7834-44
Fibrinogen gene variation and ischemic stroke.
Jood K, Danielson J, Ladenvall C, Blomstrand C, Jern C
Journal of thrombosis and haemostasis : JTH 2008 Jun;6(6):897-904
Journal of thrombosis and haemostasis : JTH 2008 Jun;6(6):897-904
No comments: Submit comment
No validations: Submit validation data