Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA044850 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA044850, RRID:AB_10961012
- Product name
- Anti-NCBP2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKL
LKKSCTLYVGNLS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references CBC–ARS2 stimulates 3′-end maturation of multiple RNA families and favors cap-proximal processing
Hallais M, Pontvianne F, Andersen P, Clerici M, Lener D, Benbahouche N, Gostan T, Vandermoere F, Robert M, Cusack S, Verheggen C, Jensen T, Bertrand E
Nature Structural & Molecular Biology 2013;20(12):1358-1366
Nature Structural & Molecular Biology 2013;20(12):1358-1366
No comments: Submit comment
No validations: Submit validation data