Antibody data

Product number
H00022916-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022916-M02, RRID:AB_1679022
Product name
NCBP2 monoclonal antibody (M02), clone 3A12
Provider product page
Abnova Corporation - H00022916-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NCBP2.
Antigen sequence
MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKL
LKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKII
MGLDKMKKTACGFCFVEYYSRADAENAMR
Isotype
IgG
Antibody clone number
3A12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -