HPA027288

POLR3GL antibody from Atlas Antibodies
flj32422, MGC3200
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027288
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027288, RRID:AB_10545872
Product name
Anti-POLR3GL
Provider product page
Atlas Antibodies - HPA027288
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEE
GEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYS
D
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -