Antibody data

Product number
PAB22018
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22018, RRID:AB_10964800
Product name
POLR3GL polyclonal antibody
Provider product page
Abnova Corporation - PAB22018
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant POLR3GL.
Antigen sequence
VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEE
GEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYS
D
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -