HPA027288

POLR3GL antibody from MilliporeSigma / Merck KGaA
flj32422, MGC3200
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027288
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027288, RRID:AB_10602119
Product name
Anti-POLR3GL antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027288
Antibody type
Polyclonal
Antigen
polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEE
GEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYS
D
Storage
-20C
Provider Type Product Number
- No reagents -