HPA027516

POLR3C antibody from MilliporeSigma / Merck KGaA
RPC3, RPC62
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027516
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027516, RRID:AB_10600894
Product name
Anti-POLR3C antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027516
Antibody type
Polyclonal
Antigen
polymerase (RNA) III (DNA directed) polypeptide C (62kD) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VINLHKALASLATATLESVVQERFGSRCARIFRLV
LQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFM
SLQEIPKTPDHAPSRTFYLYTVNILSAARM
Storage
-20C
Provider Type Product Number
- No reagents -