Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502938 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Acid Phosphatase 6, Lysophosphatidic (ACP6) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACP6 antibody: synthetic peptide directed towards the N terminal of human ACP6
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPL
EEQVE WNPQLLEVPP- Vial size
- 50 µg
Submitted references Large-scale mapping of human protein-protein interactions by mass spectrometry.
Ewing RM, Chu P, Elisma F, Li H, Taylor P, Climie S, McBroom-Cerajewski L, Robinson MD, O'Connor L, Li M, Taylor R, Dharsee M, Ho Y, Heilbut A, Moore L, Zhang S, Ornatsky O, Bukhman YV, Ethier M, Sheng Y, Vasilescu J, Abu-Farha M, Lambert JP, Duewel HS, Stewart II, Kuehl B, Hogue K, Colwill K, Gladwish K, Muskat B, Kinach R, Adams SL, Moran MF, Morin GB, Topaloglou T, Figeys D
Molecular systems biology 2007;3:89
Molecular systems biology 2007;3:89
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting