H00151242-M01A

PPP1R1C antibody from Abnova Corporation
Inhibitor-1-like
No application information provided.

Antibody data

Product number
H00151242-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00151242-M01A, RRID:AB_1204823
Product name
PPP1R1C monoclonal antibody (M01A), clone 2G7
Provider product page
Abnova Corporation - H00151242-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PPP1R1C.
Antigen sequence
MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTP
ASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRK
QSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREE
QRDH
Isotype
IgM
Antibody clone number
2G7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -