Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00151242-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00151242-D01P, RRID:AB_1711618
- Product name
- PPP1R1C purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human PPP1R1C protein.
- Antigen sequence
MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTP
ASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRK
QSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREE
QRDH- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PPP1R1C expression in transfected 293T cell line (H00151242-T02) by PPP1R1C MaxPab polyclonal antibody.Lane 1: PPP1R1C transfected lysate(12.30 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to PPP1R1C on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol