HPA000287

GPKOW antibody from Atlas Antibodies
GPATC5, GPATCH5, Spp2, T54
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000287
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000287, RRID:AB_611528
Product name
Anti-GPKOW
Provider product page
Atlas Antibodies - HPA000287
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ELQSVKPQEAPKELVIPLIQNGHRRQPPARPPGPS
TDTGALADGVVSQAVKELIAESKKSLEERENAGVD
PTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYE
A
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -