HPA001894

GPKOW antibody from Atlas Antibodies
GPATC5, GPATCH5, Mos2, Spp2, T54
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001894
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001894, RRID:AB_1079014
Product name
Anti-GPKOW
Provider product page
Atlas Antibodies - HPA001894
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGL
YGKVEGLDPDNVRAMVRLAVGSRVVTVSEYYLRPV
SQQEFDKNTLDLRQQNGTASSRKTLWNQELYIQQD
NSERKRKHLPD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -